PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015877442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 192aa    MW: 21039.9 Da    PI: 8.4615
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015877442.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601322.5e-41171161100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+l+r+C ++C++apyf +++pkkfa vhk+FGasnv+k+l+++ ee+reda++sl+yeAear+rdPvyG++g i  lq+++ +l+++la
  XP_015877442.1  17 SCAACKFLKRRCIPNCIFAPYFRSDEPKKFAKVHKVFGASNVSKILNEVAEEQREDAVNSLAYEAEARLRDPVYGCIGAIAMLQRKMVELQNDLA 111
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     l++++
  XP_015877442.1 112 LARAR 116
                     99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.03916117IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4017114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MVDAMKGGGH RARSSTSCAA CKFLKRRCIP NCIFAPYFRS DEPKKFAKVH KVFGASNVSK  60
ILNEVAEEQR EDAVNSLAYE AEARLRDPVY GCIGAIAMLQ RKMVELQNDL ALARARLAAR  120
CATNISSFSS SSSSSSYTIF DDRLTGTSLS GMQSAAYNGF TDSLSCYSSS TNLTESIPHG  180
LMYDYSYVPY IL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877442.11e-141PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL82e-61LBD21_ARATH; LOB domain-containing protein 21
TrEMBLM5X1A84e-76M5X1A8_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01450.t012e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59443353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.12e-55LOB domain-containing protein 21